PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID EPS61273.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Lentibulariaceae; Genlisea
Family G2-like
Protein Properties Length: 69aa    MW: 8244.51 Da    PI: 11.6019
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
EPS61273.1genomeLSMUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like103.51.3e-321065156
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56
                k+r++W+peLH+rF++a+++LGGs+ AtPk+i+e+mkv+gLt+++vkSHLQkYRl+
  EPS61273.1 10 KARRCWSPELHQRFLHALQRLGGSNLATPKQIRETMKVDGLTNDEVKSHLQKYRLH 65
                68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.075767IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.9E-29768IPR009057Homeodomain-like
SuperFamilySSF466891.67E-18967IPR009057Homeodomain-like
TIGRFAMsTIGR015579.7E-281065IPR006447Myb domain, plants
PfamPF002496.7E-91263IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 69 aa     Download sequence    Send to blast
KRKQAKEERK ARRCWSPELH QRFLHALQRL GGSNLATPKQ IRETMKVDGL TNDEVKSHLQ  60
KYRLHSRRP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009413646.12e-34PREDICTED: transcription factor LUX-like
RefseqXP_003631224.12e-34PREDICTED: probable transcription factor GLK2
SwissprotQ94DH31e-14PCL1_ORYSJ; Transcription factor PCL1
TrEMBLS8DEQ16e-45S8DEQ1_9LAMI; Uncharacterized protein (Fragment)
STRINGVIT_01s0011g03110.t016e-34(Vitis vinifera)
STRINGGSMUA_Achr8P18270_0018e-34(Musa acuminata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52192438
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.15e-32G2-like family protein
Publications ? help Back to Top
  1. Leushkin EV, et al.
    The miniature genome of a carnivorous plant Genlisea aurea contains a low number of genes and short non-coding sequences.
    BMC Genomics, 2013. 14: p. 476
    [PMID:23855885]